PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco017281.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family BBR-BPC
Protein Properties Length: 269aa    MW: 29632.6 Da    PI: 10.2525
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco017281.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind2462.5e-7591268124301
    GAGA_bind 124 velreeeklealpieeaaeeakekkkkk..krqrakkpkekkakkkkkksekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGal 219
                     + +  +++ ++ e ++++ + k+++  k+++ + +k+ + k++kk+s+ks   +kkes+  + k e+ks++  l gv lD s++PvPvCsCtG+ 
  Aco017281.1  91 PRSSPMIDIHSAQVDEGEPQNLDGKQQSstKKANRTAAKALRPKEPKKRSSKS--AKKKESCVANGKVERKSLEHDLGGVMLDLSSVPVPVCSCTGVA 186
                  33333444444444444444444333330033444555666667777755555..4445555578********************************* PP

    GAGA_bind 220 rqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                  r+CY+WG+GGWqS+CCt tiS yPLP+s+ r+g+R+agrKmS ga++klL++LaaeG+dls +vDLkdhWA+HGtnkfvti+
  Aco017281.1 187 RRCYRWGTGGWQSSCCTKTISEYPLPMSPSRPGSRLAGRKMSVGAYEKLLQRLAAEGHDLSYAVDLKDHWARHGTNKFVTIK 268
                  *********************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012262.7E-821268IPR010409GAGA-binding transcriptional activator
PfamPF062173.9E-7149268IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MDGSGRLGPR NWEFSDRDRR GESMLKPRPG VPAHNNVIHG HHETSLKMSS YSGRDSLIAE  60
HNSELPSMDF SWVPQKNFFP ASKAIIQEVP PRSSPMIDIH SAQVDEGEPQ NLDGKQQSST  120
KKANRTAAKA LRPKEPKKRS SKSAKKKESC VANGKVERKS LEHDLGGVML DLSSVPVPVC  180
SCTGVARRCY RWGTGGWQSS CCTKTISEYP LPMSPSRPGS RLAGRKMSVG AYEKLLQRLA  240
AEGHDLSYAV DLKDHWARHG TNKFVTIK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010920036.11e-110PREDICTED: protein BASIC PENTACYSTEINE7 isoform X1
RefseqXP_010920035.11e-110PREDICTED: protein BASIC PENTACYSTEINE7 isoform X1
RefseqXP_010920034.11e-110PREDICTED: protein BASIC PENTACYSTEINE7 isoform X1
RefseqXP_010920033.11e-110PREDICTED: protein BASIC PENTACYSTEINE7 isoform X1
TrEMBLM0TCN97e-78M0TCN9_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P34460_0012e-77(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2077767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35550.11e-55basic pentacysteine 7